Web Analysis for Watchintenselyswiftthefile - watchintenselyswiftthefile.vip
2.50
Rating by CuteStat
watchintenselyswiftthefile.vip is 2 years 9 months old. It is a domain having vip extension. It has a global traffic rank of #3860262 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, watchintenselyswiftthefile.vip is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Traffic Report
| Daily Unique Visitors: | 218 |
| Daily Pageviews: | 436 |
Estimated Valuation
| Income Per Day: | $ 1.00 |
| Estimated Worth: | $ 240.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Alexa Rank: | 3,860,262 |
| Domain Authority: | Not Applicable |
Web Server Information
Hosted IP Address:
18.215.40.75
Hosted Country:
US
Location Latitude:
39.0469Location Longitude:
-77.4903Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 18.215.40.75)
HTTP Header Analysis
HTTP/1.1 404 Not Found
Date: Fri, 30 Jul 2021 21:33:38 GMT
Content-Type: text/html
Content-Length: 552
Connection: keep-alive
Server: nginx
Date: Fri, 30 Jul 2021 21:33:38 GMT
Content-Type: text/html
Content-Length: 552
Connection: keep-alive
Server: nginx
Domain Information
| Domain Registrar: |
NameCheap, Inc.
|
|---|---|
| Registration Date: | Jul 29, 2021, 3:57 PM 2 years 9 months 2 weeks ago |
| Expiration Date: | Jul 29, 2022, 3:57 PM 1 year 9 months 1 week ago |
| Domain Status: |
clienttransferprohibited
addperiod
|
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| dns1.registrar-servers.com |
|
156.154.132.200 |
United States of America
|
| dns2.registrar-servers.com |
|
156.154.133.200 |
United States of America
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| watchintenselyswiftthefile.vip | A | 57 |
IP: 18.215.40.75 |
| watchintenselyswiftthefile.vip | NS | 1800 |
Target: dns1.registrar-servers.com |
| watchintenselyswiftthefile.vip | NS | 1800 |
Target: dns2.registrar-servers.com |
| watchintenselyswiftthefile.vip | SOA | 3601 |
MNAME: dns1.registrar-servers.com RNAME: hostmaster.registrar-servers.com Serial: 1627553579 Refresh: 43200 Retry: 3600 Expire: 604800 Minimum TTL: 3601 |
| watchintenselyswiftthefile.vip | MX | 1800 |
Priority: 20 Target: eforward5.registrar-servers.com |
| watchintenselyswiftthefile.vip | MX | 1800 |
Priority: 15 Target: eforward4.registrar-servers.com |
| watchintenselyswiftthefile.vip | MX | 1800 |
Priority: 10 Target: eforward1.registrar-servers.com |
| watchintenselyswiftthefile.vip | MX | 1800 |
Priority: 10 Target: eforward2.registrar-servers.com |
| watchintenselyswiftthefile.vip | MX | 1800 |
Priority: 10 Target: eforward3.registrar-servers.com |
| watchintenselyswiftthefile.vip | TXT | 1800 |
TXT: v=spf1 include:spf.efwd.registrar-servers.com ~all |
Similarly Ranked Websites
Welcome to Decentraland
Create, explore and trade in the first-ever virtual world owned by its users.
3,860,263
$
480.00
Full WHOIS Lookup
Domain name: watchintenselyswiftthefile.vip
Registry Domain ID: D_0228CBAA_6712A12E4A7044DFA149EA79E291ADD4_0000017AF1C0A46E-VIP
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2021-07-29T10:12:51.94Z
Registrar Registration Expiration Date: 2022-07-29T10:12:51.94Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: Withheld for Privacy Purposes
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 43decd57ab764a7c8a3080b3b762821e.protect@withheldforprivacy.com
Registry Admin ID:
Admin Name: Withheld for Privacy Purposes
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 43decd57ab764a7c8a3080b3b762821e.protect@withheldforprivacy.com
Registry Tech ID:
Tech Name: Withheld for Privacy Purposes
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 43decd57ab764a7c8a3080b3b762821e.protect@withheldforprivacy.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-07-30T18:33:41.37Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registry Domain ID: D_0228CBAA_6712A12E4A7044DFA149EA79E291ADD4_0000017AF1C0A46E-VIP
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2021-07-29T10:12:51.94Z
Registrar Registration Expiration Date: 2022-07-29T10:12:51.94Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: Withheld for Privacy Purposes
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 43decd57ab764a7c8a3080b3b762821e.protect@withheldforprivacy.com
Registry Admin ID:
Admin Name: Withheld for Privacy Purposes
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 43decd57ab764a7c8a3080b3b762821e.protect@withheldforprivacy.com
Registry Tech ID:
Tech Name: Withheld for Privacy Purposes
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 43decd57ab764a7c8a3080b3b762821e.protect@withheldforprivacy.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-07-30T18:33:41.37Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
